FOR RESEARCH USE ONLY. Not for diagnostic or therapeutic use. Not for human or veterinary administration.

← Product catalogue

α-Bungarotoxin (α-Bgt)

Bungarus multicinctus · MCI-SNK-020

For research use only. Not intended for diagnostic or therapeutic use.

Technical specifications

Catalogue numberMCI-SNK-020
Product familySnake
Source speciesBungarus multicinctus
Length74 amino acids
Disulfide bridges5
Purity>95% (RP-HPLC)
UniProt accessionP60615 ↗

Target / properties

Long-chain 3FTx. Near-irreversible antagonist of muscle nAChR (Kd 1 pM–1 nM) and neuronal α7 (IC50 1.6 nM); inactive on α3β4. Bridges 3-23, 16-44, 29-33, 48-59, 60-65. Historical tool for nAChR identification and quantification.

Sequence

IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

Key reference

Chang & Lee, Arch Int Pharmacodyn Ther 1963, 144:241 ; Mebs, Hoppe-Seyler Z Physiol Chem 1972 ; Love & Stroud, Protein Eng 1986, 1:37

Presentation

Lyophilised powder. Certificate of analysis supplied with every batch.

Request a quote for α-Bungarotoxin