FOR RESEARCH USE ONLY. Not for diagnostic or therapeutic use. Not for human or veterinary administration.

← Product catalogue

Iberiotoxin (IbTX, α-KTx 1.3)

Hottentotta tamulus · MCI-SCO-002

For research use only. Not intended for diagnostic or therapeutic use.

Technical specifications

Catalogue numberMCI-SCO-002
Product familyScorpion
Source speciesHottentotta tamulus
Length37 amino acids
Disulfide bridges3
Purity>95% (RP-HPLC)
UniProt accessionP24663 ↗

Target / properties

Selective BK blocker; inactive on Kv channels.

Sequence

ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

Key reference

Galvez, J Biol Chem 1990, 265:11083

Presentation

Lyophilised powder. Certificate of analysis supplied with every batch.

Request a quote for Iberiotoxin