FOR RESEARCH USE ONLY. Not for diagnostic or therapeutic use. Not for human or veterinary administration.

← Product catalogue

Kaliotoxin (KTX, α-KTx 3.1)

Androctonus mauretanicus mauretanicus · MCI-SCO-006

For research use only. Not intended for diagnostic or therapeutic use.

Technical specifications

Catalogue numberMCI-SCO-006
Product familyScorpion
Source speciesAndroctonus mauretanicus mauretanicus
Length38 amino acids
Disulfide bridges3
Purity>95% (RP-HPLC)
UniProt accessionP24662 ↗

Target / properties

Kv1.3 > Kv1.1, BK.

Sequence

GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK

Key reference

Crest, J Biol Chem 1992, 267:1640

Presentation

Lyophilised powder. Certificate of analysis supplied with every batch.

Request a quote for Kaliotoxin