FOR RESEARCH USE ONLY. Not for diagnostic or therapeutic use. Not for human or veterinary administration.

← Product catalogue

Margatoxin (MgTX, α-KTx 2.2)

Centruroides margaritatus · MCI-SCO-003

For research use only. Not intended for diagnostic or therapeutic use.

Technical specifications

Catalogue numberMCI-SCO-003
Product familyScorpion
Source speciesCentruroides margaritatus
Length39 amino acids
Disulfide bridges3
Purity>95% (RP-HPLC)
UniProt accessionP40755 ↗

Target / properties

Kv1.3 (50 pM), Kv1.6. T-lymphocyte immunosuppressant.

Sequence

TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

Key reference

Garcia-Calvo, J Biol Chem 1993, 268:18866

Presentation

Lyophilised powder. Certificate of analysis supplied with every batch.

Request a quote for Margatoxin