FOR RESEARCH USE ONLY. Not for diagnostic or therapeutic use. Not for human or veterinary administration.

← Product catalogue

Noxiustoxin (NTX, α-KTx 2.1)

Centruroides noxius · MCI-SCO-004

For research use only. Not intended for diagnostic or therapeutic use.

Technical specifications

Catalogue numberMCI-SCO-004
Product familyScorpion
Source speciesCentruroides noxius
Length39 amino acids
Disulfide bridges3
Purity>95% (RP-HPLC)
UniProt accessionP08815 ↗

Target / properties

Kv1.2, Kv1.3; partial effect on BK.

Sequence

TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN

Key reference

Carbone, Nature 1982, 296:90

Presentation

Lyophilised powder. Certificate of analysis supplied with every batch.

Request a quote for Noxiustoxin